Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 876555..877215 | Replicon | chromosome |
Accession | NZ_LR134315 | ||
Organism | Escherichia coli strain NCTC9064 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | EL184_RS04290 | Protein ID | WP_096835313.1 |
Coordinates | 876802..877215 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | EL184_RS04285 | Protein ID | WP_000354046.1 |
Coordinates | 876555..876821 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL184_RS04260 | 871843..872586 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
EL184_RS04265 | 872643..874076 | - | 1434 | WP_001343615.1 | 6-phospho-beta-glucosidase BglA | - |
EL184_RS04270 | 874121..874432 | + | 312 | WP_001182947.1 | N(4)-acetylcytidine aminohydrolase | - |
EL184_RS04275 | 874596..875255 | + | 660 | WP_096835312.1 | hemolysin III family protein | - |
EL184_RS04280 | 875332..876312 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
EL184_RS04285 | 876555..876821 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
EL184_RS04290 | 876802..877215 | + | 414 | WP_096835313.1 | protein YgfX | Toxin |
EL184_RS04295 | 877249..877770 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
EL184_RS04300 | 877882..878778 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
EL184_RS04305 | 878802..879512 | + | 711 | WP_000715231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL184_RS04310 | 879518..881251 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16245.14 Da Isoelectric Point: 11.7064
>T287638 WP_096835313.1 NZ_LR134315:876802-877215 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLTDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLTDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |