Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
| Location | 679495..680218 | Replicon | chromosome |
| Accession | NZ_LR134315 | ||
| Organism | Escherichia coli strain NCTC9064 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | EL184_RS03325 | Protein ID | WP_063941845.1 |
| Coordinates | 679898..680218 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | EL184_RS03320 | Protein ID | WP_096835290.1 |
| Coordinates | 679495..679830 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL184_RS03295 | 675010..675447 | + | 438 | WP_096835285.1 | hypothetical protein | - |
| EL184_RS03300 | 675510..675908 | + | 399 | WP_096835286.1 | hypothetical protein | - |
| EL184_RS03305 | 676354..677532 | - | 1179 | WP_096835287.1 | hypothetical protein | - |
| EL184_RS03310 | 677639..678364 | - | 726 | WP_157912351.1 | hypothetical protein | - |
| EL184_RS03315 | 679002..679481 | + | 480 | WP_096835289.1 | DNA repair protein RadC | - |
| EL184_RS03320 | 679495..679830 | + | 336 | WP_096835290.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL184_RS03325 | 679898..680218 | + | 321 | WP_063941845.1 | TA system toxin CbtA family protein | Toxin |
| EL184_RS03330 | 680332..681165 | + | 834 | WP_096835291.1 | DUF4942 domain-containing protein | - |
| EL184_RS03340 | 681468..681974 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| EL184_RS03345 | 682053..683894 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12095.73 Da Isoelectric Point: 5.5094
>T287637 WP_063941845.1 NZ_LR134315:679898-680218 [Escherichia coli]
MQISTVPATLPVSSRLSPVQVWQQLLTYLLEQHYGLTLNDTPFHDDSAIHEHIEAGITLADAVNFLVERYELIRTDRKGF
TWQEQTPFLTATDILRARRATGLMNT
MQISTVPATLPVSSRLSPVQVWQQLLTYLLEQHYGLTLNDTPFHDDSAIHEHIEAGITLADAVNFLVERYELIRTDRKGF
TWQEQTPFLTATDILRARRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|