Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1066818..1067430 | Replicon | chromosome |
| Accession | NZ_LR134314 | ||
| Organism | Streptococcus pyogenes strain NCTC8302 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q5X9X8 |
| Locus tag | EL107_RS05450 | Protein ID | WP_011018227.1 |
| Coordinates | 1067095..1067430 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | EL107_RS05445 | Protein ID | WP_002988079.1 |
| Coordinates | 1066818..1067105 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL107_RS05420 | 1062009..1062992 | - | 984 | WP_011184964.1 | tagatose-bisphosphate aldolase | - |
| EL107_RS05425 | 1062996..1063925 | - | 930 | WP_011184965.1 | tagatose-6-phosphate kinase | - |
| EL107_RS05430 | 1063971..1064486 | - | 516 | WP_011184966.1 | galactose-6-phosphate isomerase subunit LacB | - |
| EL107_RS05435 | 1064521..1064949 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
| EL107_RS05440 | 1065395..1066168 | + | 774 | WP_011184967.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| EL107_RS05445 | 1066818..1067105 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| EL107_RS05450 | 1067095..1067430 | + | 336 | WP_011018227.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL107_RS09485 | 1067528..1068566 | + | 1039 | Protein_1035 | site-specific integrase | - |
| EL107_RS05475 | 1068698..1069090 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| EL107_RS05480 | 1069111..1069557 | - | 447 | WP_011018228.1 | 50S ribosomal protein L13 | - |
| EL107_RS05485 | 1069775..1069981 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| EL107_RS05490 | 1069978..1070676 | - | 699 | WP_021340263.1 | hypothetical protein | - |
| EL107_RS05495 | 1070812..1071672 | - | 861 | WP_002982687.1 | DegV family protein | - |
| EL107_RS05500 | 1071769..1072287 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13171.97 Da Isoelectric Point: 5.2144
>T287633 WP_011018227.1 NZ_LR134314:1067095-1067430 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z2QKE7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |