Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1850308..1851056 | Replicon | chromosome |
| Accession | NZ_LR134313 | ||
| Organism | Neisseria canis strain NCTC10296 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | EL143_RS08760 | Protein ID | WP_085415883.1 |
| Coordinates | 1850308..1850784 (-) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | EL143_RS08765 | Protein ID | WP_197719588.1 |
| Coordinates | 1850790..1851056 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL143_RS08725 | 1845767..1846990 | + | 1224 | WP_085415788.1 | TraB/VirB10 family protein | - |
| EL143_RS08730 | 1846987..1847622 | + | 636 | WP_085415789.1 | TraV family lipoprotein | - |
| EL143_RS08735 | 1847642..1847998 | + | 357 | WP_085415790.1 | hypothetical protein | - |
| EL143_RS08740 | 1848007..1848453 | + | 447 | WP_126326712.1 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| EL143_RS08745 | 1848609..1849022 | + | 414 | WP_085415791.1 | hypothetical protein | - |
| EL143_RS08750 | 1849038..1849610 | + | 573 | WP_085415882.1 | DUF882 domain-containing protein | - |
| EL143_RS08755 | 1849640..1850284 | + | 645 | WP_085415792.1 | hypothetical protein | - |
| EL143_RS08760 | 1850308..1850784 | - | 477 | WP_085415883.1 | GNAT family N-acetyltransferase | Toxin |
| EL143_RS08765 | 1850790..1851056 | - | 267 | WP_197719588.1 | DUF1778 domain-containing protein | Antitoxin |
| EL143_RS08770 | 1851297..1852007 | + | 711 | WP_085415793.1 | recombinase family protein | - |
| EL143_RS08775 | 1852143..1853579 | + | 1437 | WP_085415794.1 | ParB/Srx family N-terminal domain-containing protein | - |
| EL143_RS08780 | 1853661..1854524 | + | 864 | WP_085415795.1 | DNA adenine methylase | - |
| EL143_RS08785 | 1854609..1855070 | + | 462 | WP_085415796.1 | virulence factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 17616.45 Da Isoelectric Point: 9.0663
>T287631 WP_085415883.1 NZ_LR134313:c1850784-1850308 [Neisseria canis]
MEKLTAPQLLSEMHVIDGFDCGIASLNEWLVKNALKNQYSNASRTFVVCDQEQTVLGYYCLAAGSLTHEEAIGAIRRNMP
SPIPIIVLGRLAVDFRAQGKELGKSLLRDAVLRSQNISQQLGARALLVHAISEEAKRFYLKYGFKSSELSPYTLMRKL
MEKLTAPQLLSEMHVIDGFDCGIASLNEWLVKNALKNQYSNASRTFVVCDQEQTVLGYYCLAAGSLTHEEAIGAIRRNMP
SPIPIIVLGRLAVDFRAQGKELGKSLLRDAVLRSQNISQQLGARALLVHAISEEAKRFYLKYGFKSSELSPYTLMRKL
Download Length: 477 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|