Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2618320..2618891 | Replicon | chromosome |
| Accession | NZ_LR134312 | ||
| Organism | Enterococcus faecalis strain NCTC8745 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | EL135_RS13035 | Protein ID | WP_002354774.1 |
| Coordinates | 2618320..2618661 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | EL135_RS13040 | Protein ID | WP_002354773.1 |
| Coordinates | 2618661..2618891 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL135_RS13025 | 2614335..2617949 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| EL135_RS13035 | 2618320..2618661 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL135_RS13040 | 2618661..2618891 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| EL135_RS13045 | 2619065..2619280 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| EL135_RS13050 | 2619419..2620411 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| EL135_RS13055 | 2620675..2621304 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| EL135_RS13065 | 2621997..2623613 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T287618 WP_002354774.1 NZ_LR134312:c2618661-2618320 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|