Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4173645..4174477 | Replicon | chromosome |
| Accession | NZ_LR134311 | ||
| Organism | Escherichia coli strain NCTC9113 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | EL186_RS20225 | Protein ID | WP_000854753.1 |
| Coordinates | 4173645..4174019 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | EL186_RS20230 | Protein ID | WP_001315620.1 |
| Coordinates | 4174109..4174477 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL186_RS20180 | 4168860..4169966 | + | 1107 | WP_001315214.1 | N-acetylneuraminate epimerase | - |
| EL186_RS20185 | 4170031..4171011 | + | 981 | WP_001295601.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| EL186_RS20190 | 4171019..4171669 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| EL186_RS23590 | 4172714..4172866 | - | 153 | WP_001280445.1 | hypothetical protein | - |
| EL186_RS20215 | 4172951..4173148 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| EL186_RS20220 | 4173160..4173648 | - | 489 | WP_000777547.1 | hypothetical protein | - |
| EL186_RS20225 | 4173645..4174019 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| EL186_RS20230 | 4174109..4174477 | - | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL186_RS20235 | 4174640..4174861 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL186_RS20240 | 4174924..4175400 | - | 477 | WP_001560709.1 | RadC family protein | - |
| EL186_RS20245 | 4175416..4175901 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| EL186_RS20250 | 4175956..4176774 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
| EL186_RS20260 | 4176874..4177107 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| EL186_RS20265 | 4177186..4177641 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE | 4164995..4211258 | 46263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T287608 WP_000854753.1 NZ_LR134311:c4174019-4173645 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT287608 WP_001315620.1 NZ_LR134311:c4174477-4174109 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |