Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3727421..3728112 | Replicon | chromosome |
| Accession | NZ_LR134311 | ||
| Organism | Escherichia coli strain NCTC9113 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A2A3UTQ9 |
| Locus tag | EL186_RS18120 | Protein ID | WP_001094399.1 |
| Coordinates | 3727421..3727789 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | EL186_RS18125 | Protein ID | WP_001405555.1 |
| Coordinates | 3727810..3728112 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL186_RS18100 | 3722593..3723549 | + | 957 | WP_000643333.1 | aldehyde oxidoreductase FAD-binding subunit PaoB | - |
| EL186_RS18105 | 3723546..3725744 | + | 2199 | WP_000667065.1 | aldehyde oxidoreductase molybdenum-binding subunit PaoC | - |
| EL186_RS18110 | 3725755..3726711 | + | 957 | WP_000121356.1 | molybdenum cofactor insertion chaperone PaoD | - |
| EL186_RS18115 | 3726762..3727100 | + | 339 | Protein_3495 | LysR family transcriptional regulator | - |
| EL186_RS18120 | 3727421..3727789 | - | 369 | WP_001094399.1 | TA system toxin CbtA family protein | Toxin |
| EL186_RS18125 | 3727810..3728112 | - | 303 | WP_001405555.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL186_RS18130 | 3728219..3728863 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| EL186_RS18135 | 3728882..3729103 | - | 222 | WP_000692307.1 | DUF987 domain-containing protein | - |
| EL186_RS18140 | 3729172..3729648 | - | 477 | WP_001573263.1 | RadC family protein | - |
| EL186_RS18145 | 3729664..3730137 | - | 474 | WP_000855084.1 | antirestriction protein | - |
| EL186_RS18150 | 3730275..3730475 | - | 201 | WP_001420888.1 | hypothetical protein | - |
| EL186_RS18155 | 3730475..3731296 | - | 822 | WP_001761104.1 | DUF945 domain-containing protein | - |
| EL186_RS18165 | 3731397..3731605 | - | 209 | Protein_3504 | DUF905 domain-containing protein | - |
| EL186_RS18170 | 3731706..3732161 | - | 456 | WP_126352615.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3690853..3771277 | 80424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13568.73 Da Isoelectric Point: 7.7465
>T287606 WP_001094399.1 NZ_LR134311:c3727789-3727421 [Escherichia coli]
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|