Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3527597..3528215 | Replicon | chromosome |
| Accession | NZ_LR134311 | ||
| Organism | Escherichia coli strain NCTC9113 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EL186_RS17200 | Protein ID | WP_001291435.1 |
| Coordinates | 3527997..3528215 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EL186_RS17195 | Protein ID | WP_000344800.1 |
| Coordinates | 3527597..3527971 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL186_RS17185 | 3522686..3523879 | + | 1194 | WP_044862765.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL186_RS17190 | 3523902..3527051 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| EL186_RS17195 | 3527597..3527971 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EL186_RS17200 | 3527997..3528215 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EL186_RS17205 | 3528387..3528938 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| EL186_RS17210 | 3529054..3529524 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| EL186_RS17215 | 3529688..3531238 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EL186_RS17220 | 3531280..3531633 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| EL186_RS17230 | 3532012..3532323 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| EL186_RS17235 | 3532354..3532926 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287604 WP_001291435.1 NZ_LR134311:3527997-3528215 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT287604 WP_000344800.1 NZ_LR134311:3527597-3527971 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |