Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1424863..1425488 | Replicon | chromosome |
Accession | NZ_LR134311 | ||
Organism | Escherichia coli strain NCTC9113 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL186_RS06985 | Protein ID | WP_000911330.1 |
Coordinates | 1425090..1425488 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | EL186_RS06980 | Protein ID | WP_000450524.1 |
Coordinates | 1424863..1425090 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL186_RS06955 | 1420666..1421136 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
EL186_RS06960 | 1421136..1421708 | - | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
EL186_RS06965 | 1421854..1422732 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
EL186_RS06970 | 1422749..1423783 | + | 1035 | WP_001358397.1 | outer membrane protein assembly factor BamC | - |
EL186_RS06975 | 1423996..1424709 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EL186_RS06980 | 1424863..1425090 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
EL186_RS06985 | 1425090..1425488 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
EL186_RS06990 | 1425635..1426498 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
EL186_RS06995 | 1426513..1428528 | + | 2016 | WP_044862802.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
EL186_RS07000 | 1428602..1429300 | + | 699 | WP_000679823.1 | esterase | - |
EL186_RS07005 | 1429410..1429610 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T287597 WP_000911330.1 NZ_LR134311:1425090-1425488 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|