Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1126157..1126740 | Replicon | chromosome |
Accession | NZ_LR134311 | ||
Organism | Escherichia coli strain NCTC9113 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | EL186_RS05525 | Protein ID | WP_000254745.1 |
Coordinates | 1126405..1126740 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | EL186_RS05520 | Protein ID | WP_000581937.1 |
Coordinates | 1126157..1126405 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL186_RS05510 | 1122496..1123797 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
EL186_RS05515 | 1123845..1126079 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
EL186_RS05520 | 1126157..1126405 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EL186_RS05525 | 1126405..1126740 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
EL186_RS05530 | 1126811..1127602 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
EL186_RS05535 | 1127830..1129467 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
EL186_RS05540 | 1129555..1130853 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
EL186_RS05545 | 1130909..1131271 | - | 363 | WP_063075011.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T287596 WP_000254745.1 NZ_LR134311:1126405-1126740 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 1UB4 | |
PDB | 5CQX | |
PDB | 5CQY | |
PDB | 1MVF | |
PDB | 2MRN | |
PDB | 2MRU | |
AlphaFold DB | A0A7U9LMB4 |