Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 788603..789401 | Replicon | chromosome |
| Accession | NZ_LR134311 | ||
| Organism | Escherichia coli strain NCTC9113 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M0ZYM8 |
| Locus tag | EL186_RS03870 | Protein ID | WP_000854904.1 |
| Coordinates | 788603..788980 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL186_RS03875 | Protein ID | WP_032209873.1 |
| Coordinates | 789027..789401 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL186_RS03835 | 784003..784980 | + | 978 | WP_000633239.1 | type II secretion system minor pseudopilin GspK | - |
| EL186_RS03840 | 784977..786155 | + | 1179 | WP_000094989.1 | type II secretion system protein GspL | - |
| EL186_RS03845 | 786157..786693 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| EL186_RS03850 | 786974..787816 | - | 843 | WP_047663674.1 | DUF4942 domain-containing protein | - |
| EL186_RS03855 | 787901..788098 | - | 198 | WP_000445282.1 | DUF957 domain-containing protein | - |
| EL186_RS23620 | 788118..788606 | - | 489 | Protein_746 | hypothetical protein | - |
| EL186_RS03870 | 788603..788980 | - | 378 | WP_000854904.1 | TA system toxin CbtA family protein | Toxin |
| EL186_RS03875 | 789027..789401 | - | 375 | WP_032209873.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL186_RS03880 | 789564..789785 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| EL186_RS03885 | 789848..790324 | - | 477 | WP_001186726.1 | RadC family protein | - |
| EL186_RS03890 | 790340..790825 | - | 486 | WP_000849591.1 | antirestriction protein | - |
| EL186_RS03895 | 790880..791698 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
| EL186_RS03905 | 791798..792031 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| EL186_RS03910 | 792110..792565 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14280.26 Da Isoelectric Point: 7.2922
>T287594 WP_000854904.1 NZ_LR134311:c788980-788603 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13676.47 Da Isoelectric Point: 6.3139
>AT287594 WP_032209873.1 NZ_LR134311:c789401-789027 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADLAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLTCEADTLGSCGYVYLAVYPAQAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADLAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLTCEADTLGSCGYVYLAVYPAQAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|