Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 1556681..1557323 | Replicon | chromosome |
| Accession | NZ_LR134310 | ||
| Organism | Actinobacillus equuli strain NCTC8529 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | EL121_RS07385 | Protein ID | WP_005621659.1 |
| Coordinates | 1556681..1557052 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | EL121_RS07390 | Protein ID | WP_039198813.1 |
| Coordinates | 1557033..1557323 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL121_RS07370 | 1553188..1554042 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| EL121_RS07375 | 1554086..1554655 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
| EL121_RS07380 | 1554715..1556463 | - | 1749 | WP_039198811.1 | protein-disulfide reductase DsbD | - |
| EL121_RS07385 | 1556681..1557052 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL121_RS07390 | 1557033..1557323 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EL121_RS07395 | 1557391..1558353 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
| EL121_RS07400 | 1558426..1558923 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| EL121_RS07405 | 1559148..1559882 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| EL121_RS07410 | 1559887..1560621 | + | 735 | WP_197050930.1 | transporter substrate-binding domain-containing protein | - |
| EL121_RS07415 | 1560627..1561298 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
| EL121_RS07420 | 1561298..1561981 | + | 684 | WP_039198827.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T287591 WP_005621659.1 NZ_LR134310:1556681-1557052 [Actinobacillus equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|