Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5538095..5538681 | Replicon | chromosome |
Accession | NZ_LR134309 | ||
Organism | Pseudomonas aeruginosa strain NCTC12903 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | EL344_RS26850 | Protein ID | WP_003120987.1 |
Coordinates | 5538382..5538681 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | EL344_RS26845 | Protein ID | WP_003448662.1 |
Coordinates | 5538095..5538385 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL344_RS26825 | 5533246..5533455 | + | 210 | WP_003105733.1 | cold-shock protein | - |
EL344_RS26830 | 5533677..5535566 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
EL344_RS26835 | 5535563..5537539 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
EL344_RS26840 | 5537680..5538024 | + | 345 | WP_016851612.1 | hypothetical protein | - |
EL344_RS26845 | 5538095..5538385 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
EL344_RS26850 | 5538382..5538681 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL344_RS26855 | 5538883..5540007 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
EL344_RS26860 | 5540007..5541716 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
EL344_RS26865 | 5541720..5543045 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
EL344_RS26870 | 5543035..5543568 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5511116..5613952 | 102836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T287589 WP_003120987.1 NZ_LR134309:c5538681-5538382 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|