Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 5141103..5141711 | Replicon | chromosome |
| Accession | NZ_LR134309 | ||
| Organism | Pseudomonas aeruginosa strain NCTC12903 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
| Locus tag | EL344_RS24970 | Protein ID | WP_003123043.1 |
| Coordinates | 5141103..5141450 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0B0C355 |
| Locus tag | EL344_RS24975 | Protein ID | WP_003114155.1 |
| Coordinates | 5141460..5141711 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL344_RS24945 | 5137379..5138611 | + | 1233 | WP_016852057.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| EL344_RS33315 | 5138622..5138798 | + | 177 | WP_016852058.1 | hypothetical protein | - |
| EL344_RS24950 | 5138795..5139163 | + | 369 | WP_016852059.1 | ASCH domain-containing protein | - |
| EL344_RS24960 | 5139356..5139559 | + | 204 | WP_003098423.1 | AlpA family phage regulatory protein | - |
| EL344_RS24965 | 5139566..5140768 | - | 1203 | WP_016852061.1 | integrase family protein | - |
| EL344_RS24970 | 5141103..5141450 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL344_RS24975 | 5141460..5141711 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EL344_RS24980 | 5141925..5142908 | - | 984 | WP_016852062.1 | tyrosine-type recombinase/integrase | - |
| EL344_RS24985 | 5142908..5144200 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
| EL344_RS24990 | 5144459..5145721 | - | 1263 | WP_023093179.1 | hypothetical protein | - |
| EL344_RS24995 | 5145723..5146073 | - | 351 | WP_003159569.1 | DUF2523 domain-containing protein | - |
| EL344_RS25000 | 5146083..5146688 | - | 606 | WP_014603242.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5017571..5153034 | 135463 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T287588 WP_003123043.1 NZ_LR134309:c5141450-5141103 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B0C355 |