Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 148719..149224 | Replicon | chromosome |
| Accession | NZ_LR134309 | ||
| Organism | Pseudomonas aeruginosa strain NCTC12903 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A069QL22 |
| Locus tag | EL344_RS00675 | Protein ID | WP_003121619.1 |
| Coordinates | 148719..149000 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | EL344_RS00680 | Protein ID | WP_003112628.1 |
| Coordinates | 148997..149224 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL344_RS00650 | 143970..145319 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| EL344_RS00655 | 145368..146054 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
| EL344_RS00660 | 146155..146889 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| EL344_RS00665 | 147093..147479 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
| EL344_RS00670 | 147511..148419 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
| EL344_RS00675 | 148719..149000 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| EL344_RS00680 | 148997..149224 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| EL344_RS00685 | 149400..150020 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| EL344_RS00690 | 150121..150621 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| EL344_RS00695 | 150694..151035 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
| EL344_RS00700 | 151117..152544 | - | 1428 | WP_003083784.1 | GABA permease | - |
| EL344_RS00705 | 152713..154206 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T287583 WP_003121619.1 NZ_LR134309:c149000-148719 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A069QL22 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6XRW | |
| AlphaFold DB | Q9I707 |