Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 785306..785892 | Replicon | chromosome |
Accession | NZ_LR134308 | ||
Organism | Pseudomonas aeruginosa strain NCTC11445 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | EL295_RS03975 | Protein ID | WP_003120987.1 |
Coordinates | 785306..785605 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | EL295_RS03980 | Protein ID | WP_003448662.1 |
Coordinates | 785602..785892 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL295_RS03955 | 780419..780952 | - | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
EL295_RS03960 | 780942..782267 | - | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
EL295_RS03965 | 782271..783980 | - | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
EL295_RS03970 | 783980..785104 | - | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
EL295_RS03975 | 785306..785605 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL295_RS03980 | 785602..785892 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
EL295_RS03985 | 785963..786307 | - | 345 | WP_016851612.1 | hypothetical protein | - |
EL295_RS03990 | 786448..788424 | - | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
EL295_RS03995 | 788421..790310 | - | 1890 | WP_016851610.1 | hypothetical protein | - |
EL295_RS04000 | 790532..790741 | - | 210 | WP_003105733.1 | cold-shock protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 718512..821839 | 103327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T287576 WP_003120987.1 NZ_LR134308:785306-785605 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|