Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1202443..1203115 | Replicon | chromosome |
| Accession | NZ_LR134306 | ||
| Organism | Yersinia pseudotuberculosis strain NCTC3571 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q666S4 |
| Locus tag | EL172_RS05340 | Protein ID | WP_002215144.1 |
| Coordinates | 1202690..1203115 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | Q666S3 |
| Locus tag | EL172_RS05335 | Protein ID | WP_002209939.1 |
| Coordinates | 1202443..1202709 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL172_RS05315 | 1198217..1199320 | + | 1104 | WP_050320984.1 | hypothetical protein | - |
| EL172_RS05320 | 1199521..1200222 | + | 702 | WP_002209942.1 | hemolysin III family protein | - |
| EL172_RS05325 | 1200565..1201062 | + | 498 | WP_002209941.1 | DUF2165 family protein | - |
| EL172_RS05330 | 1201135..1202127 | - | 993 | WP_002209940.1 | tRNA-modifying protein YgfZ | - |
| EL172_RS05335 | 1202443..1202709 | + | 267 | WP_002209939.1 | FAD assembly factor SdhE | Antitoxin |
| EL172_RS05340 | 1202690..1203115 | + | 426 | WP_002215144.1 | protein YgfX | Toxin |
| EL172_RS05345 | 1203115..1203813 | + | 699 | WP_002209937.1 | two-component system response regulator CreB | - |
| EL172_RS05350 | 1203838..1205271 | + | 1434 | WP_012104678.1 | two-component system sensor histidine kinase CreC | - |
| EL172_RS05355 | 1205356..1206813 | + | 1458 | WP_012303664.1 | cell envelope integrity protein CreD | - |
| EL172_RS05360 | 1206898..1207416 | - | 519 | WP_002209934.1 | flavodoxin FldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16510.43 Da Isoelectric Point: 10.3799
>T287563 WP_002215144.1 NZ_LR134306:1202690-1203115 [Yersinia pseudotuberculosis]
VAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVRWKRH
EWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM
VAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVLLTLVVFECIRSQKRIKSCQGEIRLKPGNLVRWKRH
EWTVVKPPWITRYGVLLHLQQTGGHATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q666S4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E8XP12 |