Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1818174..1818703 Replicon chromosome
Accession NZ_LR134305
Organism Staphylococcus aureus strain NCTC1803

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag EL119_RS09600 Protein ID WP_000621175.1
Coordinates 1818174..1818536 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag EL119_RS09605 Protein ID WP_000948331.1
Coordinates 1818533..1818703 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL119_RS09570 1813488..1814258 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
EL119_RS14690 1814233..1814385 - 153 WP_172592926.1 hypothetical protein -
EL119_RS09580 1816029..1816376 - 348 Protein_1766 anti-sigma B factor RsbW -
EL119_RS09585 1816378..1816704 - 327 WP_001052491.1 anti-sigma factor antagonist -
EL119_RS09590 1816823..1817824 - 1002 Protein_1768 PP2C family protein-serine/threonine phosphatase -
EL119_RS09600 1818174..1818536 - 363 WP_000621175.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL119_RS09605 1818533..1818703 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
EL119_RS09610 1818788..1819936 - 1149 WP_001281150.1 alanine racemase -
EL119_RS09615 1820002..1820361 - 360 WP_000581198.1 holo-ACP synthase -
EL119_RS09620 1820365..1820856 - 492 WP_001286982.1 PH domain-containing protein -
EL119_RS09625 1820849..1822426 - 1578 WP_001294643.1 PH domain-containing protein -
EL119_RS09630 1822419..1822898 - 480 WP_001287084.1 hypothetical protein -
EL119_RS09635 1823107..1823667 - 561 WP_001092415.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13441.69 Da        Isoelectric Point: 10.1654

>T287556 WP_000621175.1 NZ_LR134305:c1818536-1818174 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT287556 WP_000948331.1 NZ_LR134305:c1818703-1818533 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References