Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 562434..562911 Replicon chromosome
Accession NZ_LR134305
Organism Staphylococcus aureus strain NCTC1803

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag EL119_RS03025 Protein ID WP_000052076.1
Coordinates 562434..562622 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag EL119_RS03030 Protein ID WP_001059690.1
Coordinates 562651..562911 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL119_RS02995 558421..558942 + 522 WP_000824478.1 hypothetical protein -
EL119_RS03000 559283..559969 + 687 WP_001641381.1 thermonuclease family protein -
EL119_RS03005 560326..560526 + 201 WP_001059082.1 cold-shock protein -
EL119_RS03010 561025..561243 - 219 WP_000005880.1 hypothetical protein -
EL119_RS03015 561305..561589 - 285 WP_001004402.1 hypothetical protein -
EL119_RS03020 561677..562246 - 570 WP_001106650.1 hypothetical protein -
EL119_RS03025 562434..562622 - 189 WP_000052076.1 hypothetical protein Toxin
EL119_RS03030 562651..562911 - 261 WP_001059690.1 hypothetical protein Antitoxin
EL119_RS03035 563252..563455 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
EL119_RS03040 563452..563688 - 237 WP_000368687.1 hypothetical protein -
EL119_RS03045 563913..564494 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
EL119_RS03050 564567..565184 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
EL119_RS03055 565340..565834 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
EL119_RS03060 566233..566655 - 423 WP_000974462.1 organic hydroperoxide resistance protein -
EL119_RS03065 566803..567519 + 717 WP_000150023.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T287553 WP_000052076.1 NZ_LR134305:c562622-562434 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT287553 WP_001059690.1 NZ_LR134305:c562911-562651 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References