Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2090202..2090731 | Replicon | chromosome |
| Accession | NZ_LR134304 | ||
| Organism | Staphylococcus schweitzeri strain NCTC13712 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2K4AER0 |
| Locus tag | EL116_RS10325 | Protein ID | WP_047427839.1 |
| Coordinates | 2090202..2090564 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | EL116_RS10330 | Protein ID | WP_000948331.1 |
| Coordinates | 2090561..2090731 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL116_RS10300 | 2087184..2087954 | - | 771 | WP_047427832.1 | RNA polymerase sigma factor SigB | - |
| EL116_RS10305 | 2087929..2088408 | - | 480 | WP_001190826.1 | anti-sigma B factor RsbW | - |
| EL116_RS10310 | 2088410..2088736 | - | 327 | WP_047427835.1 | anti-sigma factor antagonist | - |
| EL116_RS10315 | 2088853..2089854 | - | 1002 | WP_000390825.1 | PP2C family protein-serine/threonine phosphatase | - |
| EL116_RS10325 | 2090202..2090564 | - | 363 | WP_047427839.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL116_RS10330 | 2090561..2090731 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EL116_RS10335 | 2090816..2091964 | - | 1149 | WP_047550937.1 | alanine racemase | - |
| EL116_RS10340 | 2092033..2092392 | - | 360 | WP_047427846.1 | holo-ACP synthase | - |
| EL116_RS10345 | 2092396..2092899 | - | 504 | WP_047427849.1 | PH domain-containing protein | - |
| EL116_RS10350 | 2092886..2094478 | - | 1593 | WP_047550940.1 | PH domain-containing protein | - |
| EL116_RS10355 | 2094471..2094950 | - | 480 | WP_047550944.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13474.78 Da Isoelectric Point: 10.2631
>T287545 WP_047427839.1 NZ_LR134304:c2090564-2090202 [Staphylococcus schweitzeri]
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDNKMKEVDNALMISLGLNTMAHQKN
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDNKMKEVDNALMISLGLNTMAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K4AER0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0VRZ1 |