Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 872747..873224 Replicon chromosome
Accession NZ_LR134304
Organism Staphylococcus schweitzeri strain NCTC13712

Toxin (Protein)


Gene name TsaT Uniprot ID A0A2K4AIF3
Locus tag EL116_RS04360 Protein ID WP_047427180.1
Coordinates 872747..872935 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A2K4AIQ4
Locus tag EL116_RS04365 Protein ID WP_047532284.1
Coordinates 872964..873224 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL116_RS04330 868251..868772 + 522 WP_047551801.1 hypothetical protein -
EL116_RS04335 869110..869778 + 669 WP_047551807.1 thermonuclease family protein -
EL116_RS04340 870141..870341 + 201 WP_001059082.1 cold-shock protein -
EL116_RS04345 870920..871132 - 213 WP_047532294.1 hypothetical protein -
EL116_RS04350 871193..871477 - 285 WP_047532292.1 hypothetical protein -
EL116_RS04355 871564..872133 - 570 WP_047447825.1 hypothetical protein -
EL116_RS04360 872747..872935 - 189 WP_047427180.1 hypothetical protein Toxin
EL116_RS04365 872964..873224 - 261 WP_047532284.1 hypothetical protein Antitoxin
EL116_RS04370 873564..873767 + 204 WP_047532282.1 sterile alpha motif-like domain-containing protein -
EL116_RS04375 873764..874000 - 237 WP_047427189.1 hypothetical protein -
EL116_RS04380 874225..874806 + 582 WP_047532278.1 phosphoglycerate mutase family protein -
EL116_RS04385 874874..875491 - 618 WP_047532276.1 LysE family transporter -
EL116_RS04390 875656..876147 - 492 WP_047427198.1 GNAT family N-acetyltransferase -
EL116_RS04395 876552..876974 - 423 WP_047551810.1 organic hydroperoxide resistance protein -
EL116_RS04400 877123..877842 + 720 WP_047551813.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7220.91 Da        Isoelectric Point: 10.0437

>T287542 WP_047427180.1 NZ_LR134304:c872935-872747 [Staphylococcus schweitzeri]
MTLHFAILFWLALIFIVAGTFIFVLMKKTAKESKRESYLSFAVIFYIFGFAMLIYTLIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 10088.35 Da        Isoelectric Point: 4.1927

>AT287542 WP_047532284.1 NZ_LR134304:c873224-872964 [Staphylococcus schweitzeri]
MKNIQLNAINLVITIIFIIFNIMITYNKGLDDLCWLLPGIIICGSILIISFTIAMITKFWLSEILFFINIVLVLYYIYPI
FYDFID

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4AIF3

Antitoxin

Source ID Structure
AlphaFold DB A0A2K4AIQ4

References