Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 3786870..3787462 | Replicon | chromosome |
| Accession | NZ_LR134303 | ||
| Organism | Shewanella putrefaciens strain NCTC12093 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A252ENI2 |
| Locus tag | EL161_RS16815 | Protein ID | WP_014610888.1 |
| Coordinates | 3787208..3787462 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A252ENK1 |
| Locus tag | EL161_RS16810 | Protein ID | WP_014610929.1 |
| Coordinates | 3786870..3787211 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL161_RS22445 | 3781879..3782016 | - | 138 | WP_197721468.1 | hypothetical protein | - |
| EL161_RS16780 | 3782087..3782269 | + | 183 | WP_197721442.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EL161_RS16785 | 3782837..3783082 | + | 246 | WP_014610893.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| EL161_RS16790 | 3783082..3783399 | + | 318 | WP_014610892.1 | CcdB family protein | - |
| EL161_RS16795 | 3783754..3785121 | + | 1368 | WP_088212883.1 | HipA domain-containing protein | - |
| EL161_RS16800 | 3785118..3785498 | + | 381 | WP_086904820.1 | helix-turn-helix domain-containing protein | - |
| EL161_RS16805 | 3785667..3786707 | + | 1041 | WP_126512854.1 | IS481 family transposase | - |
| EL161_RS16810 | 3786870..3787211 | - | 342 | WP_014610929.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL161_RS16815 | 3787208..3787462 | - | 255 | WP_014610888.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL161_RS16820 | 3787818..3788369 | + | 552 | Protein_3236 | GDP-mannose 4,6-dehydratase | - |
| EL161_RS16825 | 3788441..3788617 | + | 177 | WP_197721152.1 | tyrosine-type recombinase/integrase | - |
| EL161_RS22350 | 3788695..3788859 | - | 165 | WP_014610884.1 | hypothetical protein | - |
| EL161_RS16830 | 3788881..3789606 | - | 726 | WP_126512855.1 | zeta toxin family protein | - |
| EL161_RS16835 | 3789680..3790846 | - | 1167 | WP_115014222.1 | DUF3596 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3785667..3786707 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9480.99 Da Isoelectric Point: 10.1453
>T287533 WP_014610888.1 NZ_LR134303:c3787462-3787208 [Shewanella putrefaciens]
MNKKHLRTLTAIFARPVSGAIKWSDIEALFIALGADIEEREGSRIGVVLFGEVQVYHRPHPQKETDKDAVISIKKWLERN
GVKA
MNKKHLRTLTAIFARPVSGAIKWSDIEALFIALGADIEEREGSRIGVVLFGEVQVYHRPHPQKETDKDAVISIKKWLERN
GVKA
Download Length: 255 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12379.91 Da Isoelectric Point: 4.3992
>AT287533 WP_014610929.1 NZ_LR134303:c3787211-3786870 [Shewanella putrefaciens]
MKNLMMINGVKAFIDYDPDAETFRGEFVGLNGGADFYGESVAQLEAEGAKSLSVFLEMCQERGIEPYKNFSGKFNVRISP
EVHARLNEIALSQSISLNAAVENAVNDYIAHSA
MKNLMMINGVKAFIDYDPDAETFRGEFVGLNGGADFYGESVAQLEAEGAKSLSVFLEMCQERGIEPYKNFSGKFNVRISP
EVHARLNEIALSQSISLNAAVENAVNDYIAHSA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A252ENI2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A252ENK1 |