Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
Location | 3771781..3772612 | Replicon | chromosome |
Accession | NZ_LR134303 | ||
Organism | Shewanella putrefaciens strain NCTC12093 |
Toxin (Protein)
Gene name | hepT | Uniprot ID | - |
Locus tag | EL161_RS16685 | Protein ID | WP_126512851.1 |
Coordinates | 3771781..3772197 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | mntA | Uniprot ID | - |
Locus tag | EL161_RS16690 | Protein ID | WP_088585314.1 |
Coordinates | 3772190..3772612 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL161_RS16665 | 3768248..3768412 | + | 165 | Protein_3205 | phosphoglucosamine mutase | - |
EL161_RS16670 | 3768432..3770042 | - | 1611 | WP_011787758.1 | IS1634-like element ISSpu7 family transposase | - |
EL161_RS16675 | 3770170..3771366 | + | 1197 | Protein_3207 | phosphoglucosamine mutase | - |
EL161_RS16685 | 3771781..3772197 | - | 417 | WP_126512851.1 | DUF86 domain-containing protein | Toxin |
EL161_RS16690 | 3772190..3772612 | - | 423 | WP_088585314.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
EL161_RS16695 | 3773020..3773280 | + | 261 | WP_055647496.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EL161_RS16700 | 3773282..3773629 | + | 348 | WP_055647497.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL161_RS16705 | 3773841..3775049 | + | 1209 | WP_126512852.1 | molecular chaperone DnaJ | - |
EL161_RS16710 | 3775843..3776259 | - | 417 | WP_126512853.1 | type II toxin-antitoxin system YafO family toxin | - |
EL161_RS16715 | 3776271..3776564 | - | 294 | WP_086904668.1 | antitoxin of toxin-antitoxin stability system | - |
EL161_RS16720 | 3776757..3776822 | + | 66 | WP_197721467.1 | type II toxin-antitoxin system HigB family toxin | - |
EL161_RS16725 | 3776833..3777201 | + | 369 | WP_014610936.1 | DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3768432..3770042 | 1610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16125.66 Da Isoelectric Point: 7.7517
>T287531 WP_126512851.1 NZ_LR134303:c3772197-3771781 [Shewanella putrefaciens]
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMRY
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMRY
Download Length: 417 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15861.89 Da Isoelectric Point: 5.1231
>AT287531 WP_088585314.1 NZ_LR134303:c3772612-3772190 [Shewanella putrefaciens]
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTLDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTTANDHRGRHFE
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTLDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTTANDHRGRHFE
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|