Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-YefM |
Location | 2447237..2447787 | Replicon | chromosome |
Accession | NZ_LR134303 | ||
Organism | Shewanella putrefaciens strain NCTC12093 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | EL161_RS10750 | Protein ID | WP_086903216.1 |
Coordinates | 2447237..2447536 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | EL161_RS10755 | Protein ID | WP_086903215.1 |
Coordinates | 2447545..2447787 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL161_RS10750 | 2447237..2447536 | - | 300 | WP_086903216.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL161_RS10755 | 2447545..2447787 | - | 243 | WP_086903215.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL161_RS10760 | 2447981..2448724 | - | 744 | WP_086903214.1 | hypothetical protein | - |
EL161_RS10765 | 2448735..2449988 | - | 1254 | WP_086903213.1 | beta-ketoacyl-ACP synthase | - |
EL161_RS10770 | 2449989..2450714 | - | 726 | WP_086903212.1 | 3-ketoacyl-ACP reductase FabG2 | - |
EL161_RS10775 | 2450840..2451379 | - | 540 | WP_086903211.1 | hotdog family protein | - |
EL161_RS10780 | 2451385..2452608 | - | 1224 | WP_086903210.1 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11529.32 Da Isoelectric Point: 10.0230
>T287529 WP_086903216.1 NZ_LR134303:c2447536-2447237 [Shewanella putrefaciens]
MNNKRYKLSRLAQAHLLKIKDYTLQHFSESQWHKYKQSLISGLQMLANHPGLGRSCNDIYPNGFYFPIGKHTAYFTKEDD
FILIVALLGQPQLPQNHLK
MNNKRYKLSRLAQAHLLKIKDYTLQHFSESQWHKYKQSLISGLQMLANHPGLGRSCNDIYPNGFYFPIGKHTAYFTKEDD
FILIVALLGQPQLPQNHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|