Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1325994..1326498 | Replicon | chromosome |
| Accession | NZ_LR134303 | ||
| Organism | Shewanella putrefaciens strain NCTC12093 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | EL161_RS05770 | Protein ID | WP_126511928.1 |
| Coordinates | 1325994..1326266 (-) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | EL161_RS05775 | Protein ID | WP_055646663.1 |
| Coordinates | 1326256..1326498 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL161_RS05745 | 1321609..1321908 | + | 300 | WP_088585869.1 | IS66 family insertion sequence hypothetical protein | - |
| EL161_RS05750 | 1321950..1322249 | + | 300 | WP_164717892.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| EL161_RS05755 | 1322336..1323838 | + | 1503 | WP_088585867.1 | IS66 family transposase | - |
| EL161_RS05760 | 1324033..1324746 | + | 714 | WP_197721458.1 | ATP-binding protein | - |
| EL161_RS05765 | 1324765..1325970 | - | 1206 | WP_089066614.1 | IS256-like element ISSod5 family transposase | - |
| EL161_RS05770 | 1325994..1326266 | - | 273 | WP_126511928.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL161_RS05775 | 1326256..1326498 | - | 243 | WP_055646663.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL161_RS05780 | 1327057..1327302 | + | 246 | WP_126511929.1 | hypothetical protein | - |
| EL161_RS05785 | 1328627..1329535 | + | 909 | WP_126511930.1 | hypothetical protein | - |
| EL161_RS05790 | 1329606..1330811 | - | 1206 | WP_089066614.1 | IS256-like element ISSod5 family transposase | - |
| EL161_RS05795 | 1330869..1331084 | + | 216 | WP_197721459.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1321609..1331794 | 10185 | |
| - | inside | IScluster/Tn | - | - | 1321905..1330811 | 8906 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10528.40 Da Isoelectric Point: 10.1289
>T287528 WP_126511928.1 NZ_LR134303:c1326266-1325994 [Shewanella putrefaciens]
MTYKLEFDPRALKEWKKLGDPIRQQLKKKLAEILEHPHIEANKLRDLPDCYKIKLRTSGYRLVYQVQDERITVFVVAVGK
GSVQISVSFL
MTYKLEFDPRALKEWKKLGDPIRQQLKKKLAEILEHPHIEANKLRDLPDCYKIKLRTSGYRLVYQVQDERITVFVVAVGK
GSVQISVSFL
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|