Detailed information of TA system TA287528

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-RelB
• Location: 1325994..1326498
• Replicon: chromosome
• Accession: NZ_LR134303
• Organism: Shewanella putrefaciens strain NCTC12093

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: EL161_RS05770
• Protein ID: WP_126511928.1
• Coordinates: 1325994..1326266 (-)
• Length: 91 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: EL161_RS05775
• Protein ID: WP_055646663.1
• Coordinates: 1326256..1326498 (-)
• Length: 81 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EL161_RS05745	1321609..1321908	+	300	WP_088585869.1	IS66 family insertion sequence hypothetical protein	-
EL161_RS05750	1321950..1322249	+	300	WP_164717892.1	IS66 family insertion sequence element accessory protein TnpB	-
EL161_RS05755	1322336..1323838	+	1503	WP_088585867.1	IS66 family transposase	-
EL161_RS05760	1324033..1324746	+	714	WP_197721458.1	ATP-binding protein	-
EL161_RS05765	1324765..1325970	-	1206	WP_089066614.1	IS256-like element ISSod5 family transposase	-
EL161_RS05770	1325994..1326266	-	273	WP_126511928.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
EL161_RS05775	1326256..1326498	-	243	WP_055646663.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	Antitoxin
EL161_RS05780	1327057..1327302	+	246	WP_126511929.1	hypothetical protein	-
EL161_RS05785	1328627..1329535	+	909	WP_126511930.1	hypothetical protein	-
EL161_RS05790	1329606..1330811	-	1206	WP_089066614.1	IS256-like element ISSod5 family transposase	-
EL161_RS05795	1330869..1331084	+	216	WP_197721459.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	1321609..1331794	10185
	-	inside	IScluster/Tn	-	-	1321905..1330811	8906

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (4-81)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (2-64)

Sequences

Toxin

Protein

• Length: 91 a.a.
• Molecular weight: 10528.40 Da
• Isoelectric Point: 10.1289

>T287528 WP_126511928.1 NZ_LR134303:c1326266-1325994 [Shewanella putrefaciens]
MTYKLEFDPRALKEWKKLGDPIRQQLKKKLAEILEHPHIEANKLRDLPDCYKIKLRTSGYRLVYQVQDERITVFVVAVGK
GSVQISVSFL

Nucleotide

• Length: 273 bp

Antitoxin

Protein

• Length: 81 a.a.
• Molecular weight: 8836.20 Da
• Isoelectric Point: 4.6017

>AT287528 WP_055646663.1 NZ_LR134303:c1326498-1326256 [Shewanella putrefaciens]
MGTINIRIDDELKERSFAALEKLGVSPSEALRQTLEYVATRGALPFKPVLLTADDEALITLVKERLANPRKGIEVSLDDL

Nucleotide

• Length: 243 bp