Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 5758616..5759298 | Replicon | chromosome |
Accession | NZ_LR134302 | ||
Organism | Achromobacter spanius strain NCTC13519 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL258_RS26260 | Protein ID | WP_100856032.1 |
Coordinates | 5758616..5759050 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL258_RS26265 | Protein ID | WP_100856031.1 |
Coordinates | 5759047..5759298 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL258_RS26235 | 5754293..5755282 | - | 990 | WP_100856036.1 | DMT family transporter | - |
EL258_RS26240 | 5755417..5756241 | - | 825 | WP_100857775.1 | AraC family transcriptional regulator | - |
EL258_RS26245 | 5756385..5757659 | - | 1275 | WP_100856035.1 | RNA polymerase sigma factor | - |
EL258_RS26250 | 5757656..5758063 | - | 408 | WP_100856034.1 | VOC family protein | - |
EL258_RS26255 | 5758082..5758492 | - | 411 | WP_100856033.1 | YciI family protein | - |
EL258_RS26260 | 5758616..5759050 | - | 435 | WP_100856032.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL258_RS26265 | 5759047..5759298 | - | 252 | WP_100856031.1 | Arc family DNA-binding protein | Antitoxin |
EL258_RS26270 | 5759398..5759751 | - | 354 | WP_100856030.1 | dehydrogenase | - |
EL258_RS26275 | 5759917..5760894 | - | 978 | WP_100856029.1 | OmpA family protein | - |
EL258_RS26280 | 5760891..5761796 | - | 906 | WP_100856028.1 | MotA/TolQ/ExbB proton channel family protein | - |
EL258_RS26285 | 5762095..5763909 | + | 1815 | WP_100856027.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15218.44 Da Isoelectric Point: 5.5556
>T287527 WP_100856032.1 NZ_LR134302:c5759050-5758616 [Achromobacter spanius]
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRVLAFDT
AASLEYATLMARARASGQSIGGPDGYIAATAAAHGMSVATRDIAPFEAAGVSVINPWGASHPPH
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRVLAFDT
AASLEYATLMARARASGQSIGGPDGYIAATAAAHGMSVATRDIAPFEAAGVSVINPWGASHPPH
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|