Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3924145..3924769 | Replicon | chromosome |
| Accession | NZ_LR134302 | ||
| Organism | Achromobacter spanius strain NCTC13519 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL258_RS17810 | Protein ID | WP_100857904.1 |
| Coordinates | 3924587..3924769 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL258_RS17805 | Protein ID | WP_100857414.1 |
| Coordinates | 3924145..3924537 (-) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL258_RS17785 | 3919644..3921086 | - | 1443 | WP_100857418.1 | sensor histidine kinase | - |
| EL258_RS17790 | 3921090..3921794 | - | 705 | WP_100857417.1 | response regulator transcription factor | - |
| EL258_RS17795 | 3921985..3923325 | + | 1341 | WP_100857416.1 | CitMHS family transporter | - |
| EL258_RS17800 | 3923363..3924103 | + | 741 | WP_100857415.1 | SDR family oxidoreductase | - |
| EL258_RS17805 | 3924145..3924537 | - | 393 | WP_100857414.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL258_RS17810 | 3924587..3924769 | - | 183 | WP_100857904.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL258_RS17815 | 3924938..3925279 | + | 342 | WP_100857413.1 | hypothetical protein | - |
| EL258_RS17820 | 3925299..3925736 | - | 438 | WP_100857412.1 | hypothetical protein | - |
| EL258_RS17825 | 3926204..3926407 | + | 204 | WP_050448526.1 | cold-shock protein | - |
| EL258_RS17830 | 3926462..3926719 | + | 258 | WP_100857411.1 | hypothetical protein | - |
| EL258_RS17835 | 3926912..3927829 | + | 918 | WP_100857410.1 | DUF808 domain-containing protein | - |
| EL258_RS17840 | 3928103..3928972 | + | 870 | WP_100857409.1 | hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6739.95 Da Isoelectric Point: 12.1585
>T287526 WP_100857904.1 NZ_LR134302:c3924769-3924587 [Achromobacter spanius]
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKAGHISVPHPKKDLGIGLVTKLLTQAGLK
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKAGHISVPHPKKDLGIGLVTKLLTQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13901.74 Da Isoelectric Point: 4.2687
>AT287526 WP_100857414.1 NZ_LR134302:c3924537-3924145 [Achromobacter spanius]
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWVWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWVWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|