Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 3738287..3739329 | Replicon | chromosome |
Accession | NZ_LR134302 | ||
Organism | Achromobacter spanius strain NCTC13519 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | EL258_RS16920 | Protein ID | WP_003109777.1 |
Coordinates | 3738287..3738862 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | EL258_RS16925 | Protein ID | WP_003050245.1 |
Coordinates | 3738859..3739329 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL258_RS16895 | 3734725..3735450 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
EL258_RS16900 | 3735489..3736391 | - | 903 | WP_003105624.1 | nucleotidyltransferase domain-containing protein | - |
EL258_RS16905 | 3736391..3736891 | - | 501 | WP_003090159.1 | hypothetical protein | - |
EL258_RS16910 | 3736888..3737358 | - | 471 | WP_003105626.1 | hypothetical protein | - |
EL258_RS16915 | 3737355..3738269 | - | 915 | WP_003105629.1 | AAA family ATPase | - |
EL258_RS16920 | 3738287..3738862 | - | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
EL258_RS16925 | 3738859..3739329 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL258_RS16930 | 3739533..3739916 | + | 384 | WP_003120001.1 | RAQPRD family integrative conjugative element protein | - |
EL258_RS16935 | 3739913..3740146 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
EL258_RS16940 | 3740163..3740522 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
EL258_RS16945 | 3740534..3740932 | + | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
EL258_RS16950 | 3740929..3741621 | + | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
EL258_RS16955 | 3741618..3742529 | + | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
EL258_RS16960 | 3742519..3743937 | + | 1419 | WP_020924934.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T287525 WP_003109777.1 NZ_LR134302:c3738862-3738287 [Achromobacter spanius]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT287525 WP_003050245.1 NZ_LR134302:c3739329-3738859 [Achromobacter spanius]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|