Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3582402..3582975 Replicon chromosome
Accession NZ_LR134302
Organism Achromobacter spanius strain NCTC13519

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag EL258_RS16125 Protein ID WP_100852951.1
Coordinates 3582598..3582975 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag EL258_RS16120 Protein ID WP_100852952.1
Coordinates 3582402..3582611 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL258_RS16100 3577416..3578405 + 990 WP_100852956.1 dipeptide ABC transporter ATP-binding protein -
EL258_RS16105 3578482..3579003 - 522 WP_100852955.1 hypothetical protein -
EL258_RS16110 3579321..3580247 + 927 WP_100852954.1 DMT family transporter -
EL258_RS16115 3580334..3582007 + 1674 WP_100852953.1 energy-dependent translational throttle protein EttA -
EL258_RS16120 3582402..3582611 + 210 WP_100852952.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
EL258_RS16125 3582598..3582975 + 378 WP_100852951.1 type II toxin-antitoxin system VapC family toxin Toxin
EL258_RS16130 3583051..3583584 + 534 WP_100852950.1 isochorismatase family protein -
EL258_RS16135 3583774..3583998 + 225 WP_100852949.1 glycine zipper 2TM domain-containing protein -
EL258_RS16140 3584074..3584331 - 258 WP_050448917.1 cell division topological specificity factor MinE -
EL258_RS16145 3584335..3585150 - 816 WP_100852948.1 septum site-determining protein MinD -
EL258_RS16150 3585304..3586197 - 894 WP_100852947.1 septum site-determining protein MinC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13879.20 Da        Isoelectric Point: 6.9225

>T287524 WP_100852951.1 NZ_LR134302:3582598-3582975 [Achromobacter spanius]
MILVDTSIWIDHLGASEPRLEQLLHNEFVLMHPFIVGELALGSLNKRDMVLGALTLLPQAVRASHDEAIHFLHAERLFGK
GIGYVDLHLLASTRLTPGASLWTKDKRLGSLAKTLNLSVEPPLYH

Download         Length: 378 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7578.67 Da        Isoelectric Point: 9.8652

>AT287524 WP_100852952.1 NZ_LR134302:3582402-3582611 [Achromobacter spanius]
MRTTVTLDDDLLEKARIYTGIQETSALVQQALTNLVQKEAAKRLAKLGGSSPKLKPTPRRQTETPDDLG

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References