Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1930744..1931317 | Replicon | chromosome |
Accession | NZ_LR134302 | ||
Organism | Achromobacter spanius strain NCTC13519 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL258_RS08740 | Protein ID | WP_100854122.1 |
Coordinates | 1930744..1931031 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | EL258_RS08745 | Protein ID | WP_100854121.1 |
Coordinates | 1931018..1931317 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL258_RS08730 | 1927511..1928281 | - | 771 | WP_100854124.1 | glucose 1-dehydrogenase | - |
EL258_RS08735 | 1928505..1930628 | - | 2124 | WP_100854123.1 | TonB-dependent receptor | - |
EL258_RS08740 | 1930744..1931031 | - | 288 | WP_100854122.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL258_RS08745 | 1931018..1931317 | - | 300 | WP_100854121.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL258_RS08750 | 1931541..1932020 | + | 480 | WP_100854120.1 | VOC family protein | - |
EL258_RS08755 | 1932086..1933135 | - | 1050 | WP_100854119.1 | ABC transporter substrate-binding protein | - |
EL258_RS08760 | 1933231..1934208 | - | 978 | WP_100854118.1 | GTP-binding protein | - |
EL258_RS08765 | 1934210..1935868 | - | 1659 | WP_100854117.1 | amidohydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10864.61 Da Isoelectric Point: 9.5280
>T287523 WP_100854122.1 NZ_LR134302:c1931031-1930744 [Achromobacter spanius]
VPVLEWRETAREDLLAIVDYISDDSPAAALRLVDEIQKKVVKLRERPRLYRAGRVAGTREMVIRPNYLVVYAESPRAVTI
LRVLHAAQQWPLDSA
VPVLEWRETAREDLLAIVDYISDDSPAAALRLVDEIQKKVVKLRERPRLYRAGRVAGTREMVIRPNYLVVYAESPRAVTI
LRVLHAAQQWPLDSA
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|