Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1368133..1368674 | Replicon | chromosome |
Accession | NZ_LR134302 | ||
Organism | Achromobacter spanius strain NCTC13519 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL258_RS06185 | Protein ID | WP_100854560.1 |
Coordinates | 1368133..1368408 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | EL258_RS06190 | Protein ID | WP_100854559.1 |
Coordinates | 1368408..1368674 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL258_RS06165 | 1363593..1364606 | + | 1014 | WP_100854564.1 | helix-turn-helix domain-containing protein | - |
EL258_RS06170 | 1364626..1365936 | - | 1311 | WP_100854563.1 | MHS family MFS transporter | - |
EL258_RS06175 | 1366046..1366672 | - | 627 | WP_100854562.1 | glutathione S-transferase family protein | - |
EL258_RS06180 | 1366968..1368017 | + | 1050 | WP_100854561.1 | alpha/beta hydrolase | - |
EL258_RS06185 | 1368133..1368408 | - | 276 | WP_100854560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL258_RS06190 | 1368408..1368674 | - | 267 | WP_100854559.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
EL258_RS06195 | 1368832..1369731 | + | 900 | WP_100854558.1 | helix-turn-helix domain-containing protein | - |
EL258_RS06200 | 1369860..1371545 | + | 1686 | WP_100854557.1 | thiamine pyrophosphate-binding protein | - |
EL258_RS06205 | 1371630..1372622 | + | 993 | WP_100854556.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL258_RS06210 | 1372659..1372976 | + | 318 | WP_100854555.1 | NIPSNAP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10443.20 Da Isoelectric Point: 9.6223
>T287522 WP_100854560.1 NZ_LR134302:c1368408-1368133 [Achromobacter spanius]
MELKWTSKALSDLAPLYEFLAPANAPAAARAVQALVKAPGILLTHPRIGEQLFQFEPREVRKILVGQFEVRYEIQGSIIY
VLRLWHSREER
MELKWTSKALSDLAPLYEFLAPANAPAAARAVQALVKAPGILLTHPRIGEQLFQFEPREVRKILVGQFEVRYEIQGSIIY
VLRLWHSREER
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|