Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 417765..418431 | Replicon | chromosome |
Accession | NZ_LR134302 | ||
Organism | Achromobacter spanius strain NCTC13519 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL258_RS01840 | Protein ID | WP_100857686.1 |
Coordinates | 417765..418211 (-) | Length | 149 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL258_RS01845 | Protein ID | WP_100855259.1 |
Coordinates | 418195..418431 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL258_RS01825 | 413996..414991 | - | 996 | WP_100855260.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL258_RS01830 | 415214..416989 | + | 1776 | WP_167401007.1 | dihydroxy-acid dehydratase | - |
EL258_RS01835 | 417011..417694 | + | 684 | WP_167401006.1 | GntR family transcriptional regulator | - |
EL258_RS01840 | 417765..418211 | - | 447 | WP_100857686.1 | PIN domain-containing protein | Toxin |
EL258_RS01845 | 418195..418431 | - | 237 | WP_100855259.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL258_RS01850 | 418531..419439 | - | 909 | WP_100855258.1 | LysR family transcriptional regulator | - |
EL258_RS01855 | 419563..420525 | + | 963 | WP_100855257.1 | NAD-binding protein | - |
EL258_RS01860 | 420522..421376 | + | 855 | WP_100855256.1 | 3-keto-5-aminohexanoate cleavage protein | - |
EL258_RS01865 | 421618..421776 | + | 159 | WP_100855255.1 | periplasmic nitrate reductase, NapE protein | - |
EL258_RS01870 | 421800..422117 | + | 318 | WP_100855254.1 | chaperone NapD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 16903.63 Da Isoelectric Point: 5.2332
>T287521 WP_100857686.1 NZ_LR134302:c418211-417765 [Achromobacter spanius]
IAVISDARVFLDSNILIYLLSADARRADIAEVLLKGKPFISVQVLNEVTNVCVRKLKRQWEETNEFLAMVRMFCRVVPLT
VDVHDKARQLAERYQMSFYDACIAASALAVDCQILYTEDMQADMSIDQRLTLINPFTQQRSRLAEPGF
IAVISDARVFLDSNILIYLLSADARRADIAEVLLKGKPFISVQVLNEVTNVCVRKLKRQWEETNEFLAMVRMFCRVVPLT
VDVHDKARQLAERYQMSFYDACIAASALAVDCQILYTEDMQADMSIDQRLTLINPFTQQRSRLAEPGF
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|