Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 5799185..5799690 | Replicon | chromosome |
Accession | NZ_LR134300 | ||
Organism | Pseudomonas fluorescens strain NCTC10783 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | EL286_RS27555 | Protein ID | WP_003121619.1 |
Coordinates | 5799185..5799466 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | EL286_RS27560 | Protein ID | WP_003112628.1 |
Coordinates | 5799463..5799690 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL286_RS27530 | 5794436..5795785 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
EL286_RS27535 | 5795834..5796520 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
EL286_RS27540 | 5796621..5797355 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
EL286_RS27545 | 5797559..5797945 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
EL286_RS27550 | 5797977..5798885 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
EL286_RS27555 | 5799185..5799466 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
EL286_RS27560 | 5799463..5799690 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL286_RS27565 | 5799866..5800486 | - | 621 | WP_003101226.1 | hypothetical protein | - |
EL286_RS27570 | 5800587..5801087 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
EL286_RS27575 | 5801160..5801501 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
EL286_RS27580 | 5801583..5803010 | - | 1428 | WP_003083784.1 | GABA permease | - |
EL286_RS27585 | 5803179..5804670 | - | 1492 | Protein_5317 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T287518 WP_003121619.1 NZ_LR134300:c5799466-5799185 [Pseudomonas fluorescens]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6XRW | |
AlphaFold DB | Q9I707 |