Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 3983212..3983820 | Replicon | chromosome |
Accession | NZ_LR134300 | ||
Organism | Pseudomonas fluorescens strain NCTC10783 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A3S4N9Q9 |
Locus tag | EL286_RS19155 | Protein ID | WP_031672658.1 |
Coordinates | 3983212..3983559 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | EL286_RS19160 | Protein ID | WP_003114155.1 |
Coordinates | 3983569..3983820 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL286_RS19125 | 3978571..3978843 | + | 273 | WP_003120794.1 | cysteine-rich CWC family protein | - |
EL286_RS19130 | 3978843..3979535 | + | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
EL286_RS19135 | 3979671..3980714 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
EL286_RS19140 | 3980794..3981531 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
EL286_RS19145 | 3981983..3982885 | + | 903 | WP_003098365.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
EL286_RS19155 | 3983212..3983559 | - | 348 | WP_031672658.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL286_RS19160 | 3983569..3983820 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL286_RS19165 | 3984034..3985017 | - | 984 | WP_057392395.1 | tyrosine-type recombinase/integrase | - |
EL286_RS19170 | 3985017..3986309 | - | 1293 | WP_003123045.1 | hypothetical protein | - |
EL286_RS19175 | 3986568..3987830 | - | 1263 | WP_057392396.1 | hypothetical protein | - |
EL286_RS19180 | 3987832..3988182 | - | 351 | WP_003159569.1 | DUF2523 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3983212..3998391 | 15179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12898.69 Da Isoelectric Point: 4.5143
>T287516 WP_031672658.1 NZ_LR134300:c3983559-3983212 [Pseudomonas fluorescens]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGAQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGAQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4N9Q9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |