Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3491206..3491846 | Replicon | chromosome |
| Accession | NZ_LR134300 | ||
| Organism | Pseudomonas fluorescens strain NCTC10783 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL286_RS16790 | Protein ID | WP_003105740.1 |
| Coordinates | 3491206..3491616 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q6X2S2 |
| Locus tag | EL286_RS16795 | Protein ID | WP_003158175.1 |
| Coordinates | 3491616..3491846 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL286_RS16745 | 3487048..3487245 | + | 198 | WP_003105756.1 | hypothetical protein | - |
| EL286_RS16750 | 3487401..3488129 | + | 729 | WP_003105754.1 | TIGR03761 family integrating conjugative element protein | - |
| EL286_RS16755 | 3488135..3488683 | + | 549 | WP_003105753.1 | DUF3158 family protein | - |
| EL286_RS16760 | 3488730..3489569 | + | 840 | WP_126450664.1 | Rha family transcriptional regulator | - |
| EL286_RS16765 | 3489599..3490087 | + | 489 | WP_003105748.1 | single-stranded DNA-binding protein | - |
| EL286_RS16770 | 3490195..3490440 | + | 246 | WP_023102333.1 | CrpP family protein | - |
| EL286_RS16775 | 3490506..3490724 | - | 219 | WP_003105747.1 | hypothetical protein | - |
| EL286_RS16785 | 3490924..3491184 | - | 261 | WP_003105742.1 | hypothetical protein | - |
| EL286_RS16790 | 3491206..3491616 | - | 411 | WP_003105740.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| EL286_RS16795 | 3491616..3491846 | - | 231 | WP_003158175.1 | antitoxin | Antitoxin |
| EL286_RS16800 | 3492102..3494021 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| EL286_RS16805 | 3494329..3494538 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| EL286_RS16810 | 3494759..3496648 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3471634..3610133 | 138499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15450.81 Da Isoelectric Point: 7.3233
>T287515 WP_003105740.1 NZ_LR134300:c3491616-3491206 [Pseudomonas fluorescens]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|