Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 1222335..1223377 | Replicon | chromosome |
Accession | NZ_LR134300 | ||
Organism | Pseudomonas fluorescens strain NCTC10783 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | EL286_RS05890 | Protein ID | WP_003109777.1 |
Coordinates | 1222802..1223377 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | EL286_RS05885 | Protein ID | WP_003050245.1 |
Coordinates | 1222335..1222805 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL286_RS05850 | 1217727..1219145 | - | 1419 | WP_020924934.1 | TIGR03752 family integrating conjugative element protein | - |
EL286_RS05855 | 1219135..1220046 | - | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
EL286_RS05860 | 1220043..1220735 | - | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
EL286_RS05865 | 1220732..1221130 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
EL286_RS05870 | 1221142..1221501 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
EL286_RS05875 | 1221518..1221751 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
EL286_RS05880 | 1221748..1222131 | - | 384 | WP_003120001.1 | RAQPRD family integrative conjugative element protein | - |
EL286_RS05885 | 1222335..1222805 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL286_RS05890 | 1222802..1223377 | + | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
EL286_RS05895 | 1223395..1224309 | + | 915 | WP_003105629.1 | AAA family ATPase | - |
EL286_RS05905 | 1224673..1225128 | + | 456 | WP_023111669.1 | hypothetical protein | - |
EL286_RS05910 | 1225128..1226030 | + | 903 | WP_003105624.1 | nucleotidyltransferase domain-containing protein | - |
EL286_RS05915 | 1226069..1226794 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1175808..1272762 | 96954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T287512 WP_003109777.1 NZ_LR134300:1222802-1223377 [Pseudomonas fluorescens]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT287512 WP_003050245.1 NZ_LR134300:1222335-1222805 [Pseudomonas fluorescens]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|