Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 3759122..3759675 | Replicon | chromosome |
Accession | NZ_LR134299 | ||
Organism | Pseudomonas putida strain NCTC13186 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | EL224_RS17530 | Protein ID | WP_010953434.1 |
Coordinates | 3759122..3759415 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q88JZ4 |
Locus tag | EL224_RS17535 | Protein ID | WP_010953433.1 |
Coordinates | 3759403..3759675 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL224_RS17500 | 3754276..3754794 | - | 519 | WP_049587643.1 | DUF1993 domain-containing protein | - |
EL224_RS28975 | 3754937..3755149 | - | 213 | WP_061405625.1 | hypothetical protein | - |
EL224_RS17510 | 3755146..3755355 | - | 210 | WP_010953438.1 | 4-oxalocrotonate tautomerase family protein | - |
EL224_RS17515 | 3755425..3756156 | - | 732 | WP_010953437.1 | SDR family oxidoreductase | - |
EL224_RS17520 | 3756270..3757196 | + | 927 | WP_010953436.1 | LysR family transcriptional regulator | - |
EL224_RS17525 | 3757719..3759128 | + | 1410 | WP_010953435.1 | site-specific integrase | - |
EL224_RS17530 | 3759122..3759415 | - | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL224_RS17535 | 3759403..3759675 | - | 273 | WP_010953433.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL224_RS17540 | 3759800..3760045 | - | 246 | WP_010953432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EL224_RS17545 | 3760307..3760579 | + | 273 | WP_031299398.1 | hypothetical protein | - |
EL224_RS17550 | 3760677..3761645 | + | 969 | WP_031299399.1 | DUF932 domain-containing protein | - |
EL224_RS17555 | 3761725..3762729 | + | 1005 | WP_010953429.1 | YqaJ viral recombinase family protein | - |
EL224_RS17560 | 3762822..3763772 | + | 951 | WP_031299400.1 | hypothetical protein | - |
EL224_RS17565 | 3763744..3764103 | + | 360 | Protein_3373 | DNA repair protein RadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T287507 WP_010953434.1 NZ_LR134299:c3759415-3759122 [Pseudomonas putida]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q88JZ4 |