Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
Location | 327688..328556 | Replicon | chromosome |
Accession | NZ_LR134299 | ||
Organism | Pseudomonas putida strain NCTC13186 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL224_RS01445 | Protein ID | WP_061405554.1 |
Coordinates | 327688..328041 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | Q88R60 |
Locus tag | EL224_RS01450 | Protein ID | WP_004575922.1 |
Coordinates | 328083..328556 (+) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL224_RS01425 | 322708..324075 | - | 1368 | WP_010951639.1 | HAMP domain-containing protein | - |
EL224_RS01430 | 324077..324796 | - | 720 | WP_010951640.1 | response regulator | - |
EL224_RS01435 | 324937..327234 | + | 2298 | WP_010951641.1 | TonB-dependent siderophore receptor | - |
EL224_RS01440 | 327300..327506 | - | 207 | WP_014860378.1 | DUF3079 domain-containing protein | - |
EL224_RS01445 | 327688..328041 | + | 354 | WP_061405554.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
EL224_RS01450 | 328083..328556 | + | 474 | WP_004575922.1 | transcriptional regulator | Antitoxin |
EL224_RS01455 | 328561..328748 | - | 188 | Protein_273 | integrase | - |
EL224_RS01460 | 328976..329191 | + | 216 | WP_010951644.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL224_RS01465 | 329188..329511 | - | 324 | WP_010951645.1 | helix-turn-helix domain-containing protein | - |
EL224_RS01475 | 329973..330221 | - | 249 | WP_010951646.1 | hypothetical protein | - |
EL224_RS01480 | 330742..331017 | + | 276 | WP_049588069.1 | DUF3077 domain-containing protein | - |
EL224_RS01485 | 331372..332577 | - | 1206 | WP_010951648.1 | methyltransferase | - |
EL224_RS01490 | 332706..333395 | - | 690 | WP_010951649.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13672.88 Da Isoelectric Point: 10.6182
>T287503 WP_061405554.1 NZ_LR134299:327688-328041 [Pseudomonas putida]
MRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFESFEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIK
KNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
MRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFESFEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIK
KNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 354 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17229.67 Da Isoelectric Point: 4.4982
>AT287503 WP_004575922.1 NZ_LR134299:328083-328556 [Pseudomonas putida]
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|