Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4020629..4021443 | Replicon | chromosome |
Accession | NZ_LR134296 | ||
Organism | Escherichia coli strain NCTC9041 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | EL151_RS19645 | Protein ID | WP_001054376.1 |
Coordinates | 4020629..4020886 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | EL151_RS19650 | Protein ID | WP_001309181.1 |
Coordinates | 4020898..4021443 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL151_RS19625 | 4015917..4017023 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
EL151_RS19630 | 4017088..4018068 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EL151_RS19635 | 4018651..4019891 | - | 1241 | Protein_3795 | helicase YjhR | - |
EL151_RS19640 | 4020007..4020252 | + | 246 | Protein_3796 | GNAT family N-acetyltransferase | - |
EL151_RS19645 | 4020629..4020886 | + | 258 | WP_001054376.1 | hypothetical protein | Toxin |
EL151_RS19650 | 4020898..4021443 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
EL151_RS19655 | 4021499..4022245 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
EL151_RS19660 | 4022414..4022632 | + | 219 | Protein_3800 | hypothetical protein | - |
EL151_RS23015 | 4022670..4022786 | + | 117 | Protein_3801 | VOC family protein | - |
EL151_RS19665 | 4023031..4024152 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
EL151_RS19670 | 4024149..4024427 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EL151_RS19675 | 4024439..4025752 | + | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4013122..4029667 | 16545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T287500 WP_001054376.1 NZ_LR134296:4020629-4020886 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT287500 WP_001309181.1 NZ_LR134296:4020898-4021443 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|