Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 819750..820404 | Replicon | chromosome |
Accession | NZ_LR134296 | ||
Organism | Escherichia coli strain NCTC9041 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | EL151_RS04015 | Protein ID | WP_000244777.1 |
Coordinates | 819997..820404 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | EL151_RS04010 | Protein ID | WP_000354046.1 |
Coordinates | 819750..820016 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL151_RS03985 | 814919..815662 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
EL151_RS03990 | 815719..817152 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
EL151_RS03995 | 817197..817508 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
EL151_RS04000 | 817672..818331 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
EL151_RS04005 | 818527..819507 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
EL151_RS04010 | 819750..820016 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
EL151_RS04015 | 819997..820404 | + | 408 | WP_000244777.1 | toxin CptA | Toxin |
EL151_RS04020 | 820444..820965 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
EL151_RS04025 | 821077..821973 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
EL151_RS04030 | 821998..822708 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL151_RS04035 | 822714..824447 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T287487 WP_000244777.1 NZ_LR134296:819997-820404 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |