Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4045688..4046520 | Replicon | chromosome |
| Accession | NZ_LR134295 | ||
| Organism | Escherichia coli strain NCTC9080 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | EL145_RS19480 | Protein ID | WP_000854753.1 |
| Coordinates | 4045688..4046062 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A827QDD4 |
| Locus tag | EL145_RS19485 | Protein ID | WP_052906788.1 |
| Coordinates | 4046152..4046520 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL145_RS19435 | 4040911..4042017 | + | 1107 | WP_001315214.1 | N-acetylneuraminate epimerase | - |
| EL145_RS19440 | 4042082..4043062 | + | 981 | WP_001295601.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| EL145_RS19445 | 4043070..4043720 | - | 651 | WP_126327500.1 | HNH endonuclease | - |
| EL145_RS23040 | 4044099..4044284 | + | 186 | WP_000066585.1 | hypothetical protein | - |
| EL145_RS22815 | 4044757..4044909 | - | 153 | WP_001280445.1 | hypothetical protein | - |
| EL145_RS19470 | 4044994..4045191 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| EL145_RS19475 | 4045203..4045691 | - | 489 | WP_000777547.1 | hypothetical protein | - |
| EL145_RS19480 | 4045688..4046062 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| EL145_RS19485 | 4046152..4046520 | - | 369 | WP_052906788.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL145_RS19490 | 4046683..4046904 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| EL145_RS19495 | 4046967..4047443 | - | 477 | WP_001186774.1 | RadC family protein | - |
| EL145_RS19500 | 4047459..4047944 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| EL145_RS19505 | 4047999..4048817 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
| EL145_RS19515 | 4048917..4049150 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| EL145_RS19520 | 4049229..4049684 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T287482 WP_000854753.1 NZ_LR134295:c4046062-4045688 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13516.24 Da Isoelectric Point: 6.7432
>AT287482 WP_052906788.1 NZ_LR134295:c4046520-4046152 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A827QDD4 |