Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2516677..2517203 | Replicon | chromosome |
| Accession | NZ_LR134295 | ||
| Organism | Escherichia coli strain NCTC9080 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | EL145_RS12025 | Protein ID | WP_000323025.1 |
| Coordinates | 2516677..2516964 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | EL145_RS12030 | Protein ID | WP_000534858.1 |
| Coordinates | 2516964..2517203 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL145_RS11985 | 2512067..2512282 | - | 216 | WP_000839565.1 | phage lysis protein EssD | - |
| EL145_RS11990 | 2512534..2512908 | - | 375 | WP_001348108.1 | hypothetical protein | - |
| EL145_RS11995 | 2513080..2513508 | - | 429 | WP_000506936.1 | cell envelope integrity protein TolA | - |
| EL145_RS12000 | 2514553..2515095 | - | 543 | WP_000640161.1 | DUF1133 family protein | - |
| EL145_RS12005 | 2515092..2515382 | - | 291 | WP_000247763.1 | DUF1364 domain-containing protein | - |
| EL145_RS12010 | 2515382..2515981 | - | 600 | WP_025670565.1 | DUF1367 family protein | - |
| EL145_RS12020 | 2516450..2516605 | - | 156 | WP_000813269.1 | type I toxin-antitoxin system toxin HokD | - |
| EL145_RS12025 | 2516677..2516964 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| EL145_RS12030 | 2516964..2517203 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| EL145_RS12035 | 2517228..2517533 | + | 306 | WP_071600497.1 | hypothetical protein | - |
| EL145_RS12040 | 2517736..2518068 | + | 333 | WP_001349760.1 | FlxA-like family protein | - |
| EL145_RS12045 | 2518505..2519845 | - | 1341 | WP_000589013.1 | ISNCY family transposase | - |
| EL145_RS12060 | 2520642..2521841 | + | 1200 | WP_001117227.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2482426..2537759 | 55333 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T287477 WP_000323025.1 NZ_LR134295:c2516964-2516677 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|