Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1153472..1154134 | Replicon | chromosome |
| Accession | NZ_LR134294 | ||
| Organism | Streptococcus pneumoniae strain NCTC12977 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL096_RS06060 | Protein ID | WP_172592534.1 |
| Coordinates | 1153961..1154134 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | EL096_RS06055 | Protein ID | WP_000961810.1 |
| Coordinates | 1153472..1153924 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL096_RS06025 | 1148851..1149594 | - | 744 | WP_001188203.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| EL096_RS06030 | 1149596..1150546 | - | 951 | WP_050072374.1 | 50S ribosomal protein L11 methyltransferase | - |
| EL096_RS06035 | 1150682..1151198 | - | 517 | Protein_1155 | GNAT family N-acetyltransferase | - |
| EL096_RS06040 | 1151195..1151623 | - | 429 | WP_050072375.1 | NUDIX hydrolase | - |
| EL096_RS06045 | 1151625..1152692 | - | 1068 | WP_000719721.1 | M50 family metallopeptidase | - |
| EL096_RS06050 | 1152711..1153181 | - | 471 | WP_054387465.1 | DUF3013 family protein | - |
| EL096_RS06055 | 1153472..1153924 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL096_RS06060 | 1153961..1154134 | - | 174 | WP_172592534.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL096_RS06065 | 1154277..1154456 | - | 180 | WP_001809903.1 | hypothetical protein | - |
| EL096_RS06075 | 1154621..1154860 | - | 240 | WP_000818078.1 | hypothetical protein | - |
| EL096_RS06085 | 1155130..1156401 | + | 1272 | WP_054387466.1 | replication-associated recombination protein A | - |
| EL096_RS06095 | 1156946..1158265 | - | 1320 | WP_000502560.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6396.53 Da Isoelectric Point: 10.8214
>T287465 WP_172592534.1 NZ_LR134294:c1154134-1153961 [Streptococcus pneumoniae]
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQVGL
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQVGL
Download Length: 174 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT287465 WP_000961810.1 NZ_LR134294:c1153924-1153472 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|