Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1504614..1505226 | Replicon | chromosome |
| Accession | NZ_LR134293 | ||
| Organism | Streptococcus canis strain NCTC12191 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A4V0C1F2 |
| Locus tag | EL097_RS07640 | Protein ID | WP_003048651.1 |
| Coordinates | 1504891..1505226 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A4V0C2C3 |
| Locus tag | EL097_RS07635 | Protein ID | WP_003048654.1 |
| Coordinates | 1504614..1504901 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL097_RS07615 | 1499971..1501176 | + | 1206 | WP_003048662.1 | 30S ribosomal protein S1 | - |
| EL097_RS07620 | 1501482..1502729 | + | 1248 | WP_039994860.1 | D-alanyl-D-alanine carboxypeptidase PBP3 | - |
| EL097_RS07625 | 1502841..1503809 | - | 969 | WP_003048658.1 | polysaccharide deacetylase family protein | - |
| EL097_RS07630 | 1503995..1504437 | + | 443 | Protein_1411 | hypothetical protein | - |
| EL097_RS07635 | 1504614..1504901 | + | 288 | WP_003048654.1 | hypothetical protein | Antitoxin |
| EL097_RS07640 | 1504891..1505226 | + | 336 | WP_003048651.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL097_RS07645 | 1505849..1506704 | + | 856 | Protein_1414 | homoserine kinase | - |
| EL097_RS07650 | 1506795..1508063 | + | 1269 | WP_003048649.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
| EL097_RS07655 | 1508095..1508661 | + | 567 | WP_003048647.1 | GTP cyclohydrolase I FolE | - |
| EL097_RS07660 | 1508670..1509470 | + | 801 | WP_129545009.1 | dihydropteroate synthase | - |
| EL097_RS07665 | 1509477..1509836 | + | 360 | WP_003048644.1 | dihydroneopterin aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13215.04 Da Isoelectric Point: 6.2385
>T287460 WP_003048651.1 NZ_LR134293:1504891-1505226 [Streptococcus canis]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLKVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPARSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLKVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPARSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4V0C1F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4V0C2C3 |