Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 443258..443882 | Replicon | chromosome |
| Accession | NZ_LR134293 | ||
| Organism | Streptococcus canis strain NCTC12191 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8H2NG61 |
| Locus tag | EL097_RS02155 | Protein ID | WP_003046168.1 |
| Coordinates | 443258..443605 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A8H2NIT0 |
| Locus tag | EL097_RS02160 | Protein ID | WP_003046166.1 |
| Coordinates | 443595..443882 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL097_RS02145 | 439320..441620 | - | 2301 | WP_003046173.1 | penicillin-binding protein PBP1B | - |
| EL097_RS02150 | 441727..442986 | + | 1260 | WP_003046171.1 | tyrosine--tRNA ligase | - |
| EL097_RS02155 | 443258..443605 | - | 348 | WP_003046168.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL097_RS02160 | 443595..443882 | - | 288 | WP_003046166.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL097_RS02165 | 443951..444328 | - | 378 | WP_003046164.1 | DUF1492 domain-containing protein | - |
| EL097_RS02170 | 444318..444665 | - | 348 | WP_003046162.1 | DUF1492 domain-containing protein | - |
| EL097_RS02180 | 445062..445550 | - | 489 | WP_129544917.1 | hypothetical protein | - |
| EL097_RS02185 | 445624..446181 | - | 558 | WP_003045777.1 | hypothetical protein | - |
| EL097_RS10545 | 446183..446356 | - | 174 | WP_003045775.1 | hypothetical protein | - |
| EL097_RS02190 | 446362..446535 | - | 174 | WP_003046156.1 | hypothetical protein | - |
| EL097_RS02195 | 446870..448372 | - | 1503 | WP_003046154.1 | DNA primase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13231.99 Da Isoelectric Point: 5.5796
>T287459 WP_003046168.1 NZ_LR134293:c443605-443258 [Streptococcus canis]
MVSDNKTHSLIIPETVQEQLRAIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDGKAVFVSDIIHSKQDYIRLFKKK
MVSDNKTHSLIIPETVQEQLRAIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDGKAVFVSDIIHSKQDYIRLFKKK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|