Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1672084..1672696 Replicon chromosome
Accession NZ_LR134284
Organism Streptococcus pyogenes strain NCTC8232

Toxin (Protein)


Gene name parE Uniprot ID A0A4Z2JY48
Locus tag EL070_RS08895 Protein ID WP_002982731.1
Coordinates 1672361..1672696 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag EL070_RS08890 Protein ID WP_002988079.1
Coordinates 1672084..1672371 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL070_RS08865 1667273..1668256 - 984 WP_111705797.1 tagatose-bisphosphate aldolase -
EL070_RS08870 1668260..1669189 - 930 WP_111705798.1 tagatose-6-phosphate kinase -
EL070_RS08875 1669237..1669752 - 516 WP_111705799.1 galactose-6-phosphate isomerase subunit LacB -
EL070_RS08880 1669787..1670215 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
EL070_RS08885 1670661..1671434 + 774 WP_002982738.1 DeoR/GlpR family DNA-binding transcription regulator -
EL070_RS08890 1672084..1672371 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
EL070_RS08895 1672361..1672696 + 336 WP_002982731.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL070_RS10090 1672848..1673318 + 471 WP_164552700.1 integrase -
EL070_RS10095 1673392..1673718 + 327 WP_197710608.1 tyrosine-type recombinase/integrase -
EL070_RS08910 1673961..1674353 - 393 WP_002982716.1 30S ribosomal protein S9 -
EL070_RS08915 1674374..1674820 - 447 WP_002982710.1 50S ribosomal protein L13 -
EL070_RS08920 1675038..1675244 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
EL070_RS08925 1675241..1675939 - 699 WP_011018229.1 hypothetical protein -
EL070_RS08930 1676075..1676935 - 861 WP_011529009.1 DegV family protein -
EL070_RS08935 1677032..1677550 - 519 WP_011055010.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13145.88 Da        Isoelectric Point: 5.2144

>T287454 WP_002982731.1 NZ_LR134284:1672361-1672696 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT287454 WP_002988079.1 NZ_LR134284:1672084-1672371 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z2JY48

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References