Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3958188..3958813 | Replicon | chromosome |
Accession | NZ_LR134280 | ||
Organism | Klebsiella pneumoniae strain NCTC9793 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | EL169_RS19845 | Protein ID | WP_002882817.1 |
Coordinates | 3958188..3958571 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | EL169_RS19850 | Protein ID | WP_004150355.1 |
Coordinates | 3958571..3958813 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL169_RS19830 | 3955554..3956456 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
EL169_RS19835 | 3956453..3957088 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
EL169_RS19840 | 3957085..3958014 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
EL169_RS19845 | 3958188..3958571 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL169_RS19850 | 3958571..3958813 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
EL169_RS19855 | 3959018..3959935 | + | 918 | WP_023313778.1 | alpha/beta hydrolase | - |
EL169_RS19860 | 3959950..3960891 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
EL169_RS19865 | 3960936..3961373 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EL169_RS19870 | 3961370..3962230 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
EL169_RS19875 | 3962224..3962823 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T287450 WP_002882817.1 NZ_LR134280:c3958571-3958188 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |