Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 3354516..3355326 | Replicon | chromosome |
Accession | NZ_LR134280 | ||
Organism | Klebsiella pneumoniae strain NCTC9793 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | EL169_RS16900 | Protein ID | WP_004178461.1 |
Coordinates | 3354516..3355049 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | EL169_RS16905 | Protein ID | WP_002887278.1 |
Coordinates | 3355060..3355326 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL169_RS16895 | 3353347..3354468 | + | 1122 | WP_016946712.1 | cupin domain-containing protein | - |
EL169_RS16900 | 3354516..3355049 | - | 534 | WP_004178461.1 | GNAT family N-acetyltransferase | Toxin |
EL169_RS16905 | 3355060..3355326 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
EL169_RS16910 | 3355429..3356862 | - | 1434 | WP_040236876.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
EL169_RS16915 | 3356852..3357535 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
EL169_RS16925 | 3357707..3359089 | + | 1383 | WP_040236875.1 | Cu(I)/Ag(I) efflux RND transporter outer membrane protein | - |
EL169_RS16930 | 3359107..3359451 | + | 345 | WP_004186842.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T287447 WP_004178461.1 NZ_LR134280:c3355049-3354516 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |