Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2184263..2184792 | Replicon | chromosome |
Accession | NZ_LR134271 | ||
Organism | Staphylococcus aureus strain NCTC7988 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL099_RS11365 | Protein ID | WP_000621175.1 |
Coordinates | 2184263..2184625 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | EL099_RS11370 | Protein ID | WP_000948331.1 |
Coordinates | 2184622..2184792 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL099_RS11340 | 2181241..2182011 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
EL099_RS11345 | 2181986..2182465 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
EL099_RS11350 | 2182467..2182793 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
EL099_RS11355 | 2182912..2183913 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
EL099_RS11365 | 2184263..2184625 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL099_RS11370 | 2184622..2184792 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EL099_RS11375 | 2184877..2186025 | - | 1149 | WP_001281150.1 | alanine racemase | - |
EL099_RS11380 | 2186091..2186450 | - | 360 | WP_000581198.1 | holo-ACP synthase | - |
EL099_RS11385 | 2186454..2186945 | - | 492 | WP_001286982.1 | PH domain-containing protein | - |
EL099_RS11390 | 2186938..2188515 | - | 1578 | WP_070040361.1 | PH domain-containing protein | - |
EL099_RS11395 | 2188508..2188987 | - | 480 | WP_001287084.1 | hypothetical protein | - |
EL099_RS11400 | 2189196..2189756 | - | 561 | WP_001092415.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T287432 WP_000621175.1 NZ_LR134271:c2184625-2184263 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|