Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3956501..3957299 | Replicon | chromosome |
Accession | NZ_LR134270 | ||
Organism | Escherichia marmotae strain NCTC8196 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | EL146_RS19270 | Protein ID | WP_115425318.1 |
Coordinates | 3956922..3957299 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | EL146_RS19265 | Protein ID | WP_126511418.1 |
Coordinates | 3956501..3956875 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL146_RS19245 | 3954161..3954979 | + | 819 | WP_126511414.1 | DUF945 domain-containing protein | - |
EL146_RS19250 | 3955071..3955556 | + | 486 | WP_126511415.1 | antirestriction protein | - |
EL146_RS19255 | 3955572..3956048 | + | 477 | WP_126511416.1 | RadC family protein | - |
EL146_RS19260 | 3956117..3956338 | + | 222 | WP_126511417.1 | DUF987 domain-containing protein | - |
EL146_RS19265 | 3956501..3956875 | + | 375 | WP_126511418.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL146_RS19270 | 3956922..3957299 | + | 378 | WP_115425318.1 | TA system toxin CbtA family protein | Toxin |
EL146_RS19275 | 3957296..3957784 | + | 489 | WP_059252050.1 | hypothetical protein | - |
EL146_RS19280 | 3957796..3957993 | + | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
EL146_RS19285 | 3958078..3958923 | + | 846 | WP_126511475.1 | DUF4942 domain-containing protein | - |
EL146_RS19295 | 3959224..3959730 | + | 507 | WP_000227305.1 | G/U mismatch-specific DNA glycosylase | - |
EL146_RS19300 | 3959810..3961651 | - | 1842 | WP_000437384.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14173.15 Da Isoelectric Point: 6.9576
>T287425 WP_115425318.1 NZ_LR134270:3956922-3957299 [Escherichia marmotae]
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13787.60 Da Isoelectric Point: 6.7387
>AT287425 WP_126511418.1 NZ_LR134270:3956501-3956875 [Escherichia marmotae]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|